General Information

  • ID:  hor006431
  • Uniprot ID:  P55095
  • Protein name:  Glucagon-like peptide 2
  • Gene name:  Gcg
  • Organism:  Mus musculus (Mouse)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  [Glucagon]: Release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. |[Glucagon]: Secreted in the A cells of the islets of Langerhans. [Glucagon-like peptide 2]: Secreted from enteroendocrine cells throughout the ga
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031767 gastric inhibitory polypeptide receptor binding; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006094 gluconeogenesis; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0032092 positive regulation of protein binding; GO:0032099 negative regulation of appetite; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0045860 positive regulation of protein kinase activity; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0034774 secretory granule lumen

Sequence Information

  • Sequence:  HADGSFSDEMSTILDNLATRDFINWLIQTKITD
  • Length:  33(146-178)
  • Propeptide:  MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK
  • Signal peptide:  MKTIYFVAGLLIMLVQGSWQ
  • Modification:  T5 Phosphoserine;T7 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Gcgr, Glp1r
  • Target Unid:  Q61606, O35659
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P55095-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006431_AF2.pdbhor006431_ESM.pdb

Physical Information

Mass: 434014 Formula: C165H255N43O56S
Absent amino acids: CPVY Common amino acids: D
pI: 4.01 Basic residues: 3
Polar residues: 10 Hydrophobic residues: 12
Hydrophobicity: -27.58 Boman Index: -6520
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 88.79
Instability Index: 2201.52 Extinction Coefficient cystines: 5500
Absorbance 280nm: 171.88

Literature

  • PubMed ID:  7730317
  • Title:  Processing of mouse proglucagon by recombinant prohormone convertase 1 and immunopurified prohormone convertase 2 in vitro.
  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: th
  • PubMed ID:  1886889
  • Title:  
  • PubMed ID:  9407057
  • Title:  
  • PubMed ID:  11356850
  • Title:  
  • PubMed ID:  10605628
  • Title:  
  • PubMed ID:  10322410
  • Title:  
  • PubMed ID:  12626323
  • Title:  
  • PubMed ID:  14719035
  • Title:  
  • PubMed ID:  12554744
  • Title:  
  • PubMed ID:  21183079
  • Title:  
  • PubMed ID:  22037645
  • Title: