HORDB

General Information

ID: hor006431
Uniprot ID: P55095
Protein name: Glucagon-like peptide 2
Gene name: Gcg
Organism: Mus musculus (Mouse)
Family: Glucagon family
Source: animal
Expression: [Glucagon]: Release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. |[Glucagon]: Secreted in the A cells of the islets of Langerhans. [Glucagon-like peptide 2]: Secreted from enteroendocrine cells throughout the ga
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031767 gastric inhibitory polypeptide receptor binding; GO:0031769 glucagon receptor binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
GO BP: GO:0006094 gluconeogenesis; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0014823 response to activity; GO:0032092 positive regulation of protein binding; GO:0032099 negative regulation of appetite; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0045722 positive regulation of gluconeogenesis; GO:0045860 positive regulation of protein kinase activity; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus; GO:0051571 obsolete positive regulation of histone H3-K4 methylation; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0071377 cellular response to glucagon stimulus; GO:0090280 positive regulation of calcium ion import; GO:1900118 negative regulation of execution phase of apoptosis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0034774 secretory granule lumen

Sequence Information

Sequence: HADGSFSDEMSTILDNLATRDFINWLIQTKITD
Length: 33(146-178)
Propeptide: MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK
Signal peptide: MKTIYFVAGLLIMLVQGSWQ
Modification: T5 Phosphoserine;T7 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
Mechanism: NA
Cross BBB: NA
Target: Gcgr, Glp1r
Target Unid: Q61606, O35659
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P55095-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006431_AF2.pdb

hor006431_ESM.pdb

Physical Information

Mass:	434014	Formula:	C165H255N43O56S
Absent amino acids:	CPVY	Common amino acids:	D
pI:	4.01	Basic residues:	3
Polar residues:	10	Hydrophobic residues:	12
Hydrophobicity:	-27.58	Boman Index:	-6520
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	88.79
Instability Index:	2201.52	Extinction Coefficient cystines:	5500
Absorbance 280nm:	171.88

Literature

PubMed ID: 7730317
Title: Processing of mouse proglucagon by recombinant prohormone convertase 1 and immunopurified prohormone convertase 2 in vitro.
PubMed ID: 16141072
Title: The transcriptional landscape of the mammalian genome.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: th
PubMed ID: 1886889
Title:
PubMed ID: 9407057
Title:
PubMed ID: 11356850
Title:
PubMed ID: 10605628
Title:
PubMed ID: 10322410
Title:
PubMed ID: 12626323
Title:
PubMed ID: 14719035
Title:
PubMed ID: 12554744
Title:
PubMed ID: 21183079
Title:
PubMed ID: 22037645
Title: